PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G243900.1
Common NameB456_010G243900, LOC105774016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 616aa    MW: 67140.8 Da    PI: 6.8847
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G243900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.56e-28199252155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQk+Rl
  Gorai.010G243900.1 199 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILELMNVEKLTRENVASHLQKFRL 252
                         79*******************.********************************8 PP

2Response_reg79.51.2e-26201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ + ll ++l++ +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll++   e  +lp+i+++a+g+ +++ + 
  Gorai.010G243900.1  20 VLAVDDDPTCLLLLGTLLRRCQY-HVTTTSQAKTALKMLRENKnkFDLVISDVHMPDMDGFKLLEHVGLEM-DLPVIMLSANGDTKLVMKG 108
                         799********************.***************888888**********************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.010G243900.1 109 ITHGACDYLLKPVRIEELQN 128
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.0E-1701609IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.4E-4217141No hitNo description
SuperFamilySSF521721.38E-3517138IPR011006CheY-like superfamily
SMARTSM004487.3E-3318130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.37219134IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.0E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.41E-2421133No hitNo description
Gene3DG3DSA:1.10.10.609.8E-30196257IPR009057Homeodomain-like
PROSITE profilePS5129411.466196255IPR017930Myb domain
SuperFamilySSF466891.42E-19197256IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-25199252IPR006447Myb domain, plants
PfamPF002494.6E-6201250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MTVEQIVSEG KDQFPIGMRV LAVDDDPTCL LLLGTLLRRC QYHVTTTSQA KTALKMLREN  60
KNKFDLVISD VHMPDMDGFK LLEHVGLEMD LPVIMLSANG DTKLVMKGIT HGACDYLLKP  120
VRIEELQNIW QHVVRRKKKD RCNSGSKDKP HPDSGEAAGI GNVDNNGKLN KKRKDQNEDE  180
DDERDENGHD NEDPSAQKKP RVVWSVELHR KFVAAVNQLG IDKAVPKKIL ELMNVEKLTR  240
ENVASHLQKF RLYLKRISCV ANQQANMAAA LGTADSAYLR MGSLNGLGNF HTLAGSDQLH  300
NAAFRSFPPS GVLGRLNTPA GLGIRSLPSP GTIQLGHVQN SGNPTNDLSK LQSFVPGNHN  360
TNILQGMPMS LELDRLQHNK SVGHIGELPT TDSTTVFPGS GSLVDARITG FSNNPLLGVT  420
SNSLMLEGSS QQATSHTSVS AIGFQNGNAL SDFTSIAPAS NQLQDSKADS QGQASPINCN  480
AGQIIRSAPQ EWNAPRKDAP YQSHALINSS IPINSAMIQL GQCLDRNNSI FHRTTDLDSV  540
GPLNFVDPLS IKHSEGDNYI MEPSVIEKEG YLMFQPRPHG SHVPDNTGSL KDLASAMMKQ  600
EDDFGCNGYS LRTSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-26195258164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134139RRKKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451762.10.0PREDICTED: two-component response regulator ARR12-like isoform X1
SwissprotP625981e-153ARR12_ARATH; Two-component response regulator ARR12
TrEMBLA0A0D2RCZ20.0A0A0D2RCZ2_G
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-143response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]